Lineage for d2q2ta2 (2q2t A:2-189)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1433387Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) (S)
    has a circularly permuted topology
  5. 1433388Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
    automatically mapped to Pfam PF01068
  6. 1433389Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)
  7. 1433392Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries)
  8. 1433394Domain d2q2ta2: 2q2t A:2-189 [150015]
    Other proteins in same PDB: d2q2ta1
    automatically matched to d1p8la2
    protein/DNA complex; complexed with amp

Details for d2q2ta2

PDB Entry: 2q2t (more details), 2.3 Å

PDB Description: structure of chlorella virus dna ligase-adenylate bound to a 5' phosphorylated nick
PDB Compounds: (A:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ta2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

SCOPe Domain Coordinates for d2q2ta2:

Click to download the PDB-style file with coordinates for d2q2ta2.
(The format of our PDB-style files is described here.)

Timeline for d2q2ta2: