Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (5 species) not a true protein |
Species West Nile virus [TaxId:11082] [186921] (2 PDB entries) |
Domain d2p5pc_: 2p5p C: [149259] automated match to d1s6na_ |
PDB Entry: 2p5p (more details), 2.8 Å
SCOPe Domain Sequences for d2p5pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5pc_ b.1.18.4 (C:) automated matches {West Nile virus [TaxId: 11082]} ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks
Timeline for d2p5pc_: