Lineage for d2p5pb_ (2p5p B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111941Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1111986Protein automated matches [190183] (5 species)
    not a true protein
  7. 1111997Species West Nile virus [TaxId:11082] [186921] (2 PDB entries)
  8. 1112000Domain d2p5pb_: 2p5p B: [149258]
    automated match to d1s6na_

Details for d2p5pb_

PDB Entry: 2p5p (more details), 2.8 Å

PDB Description: Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d2p5pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5pb_ b.1.18.4 (B:) automated matches {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

SCOPe Domain Coordinates for d2p5pb_:

Click to download the PDB-style file with coordinates for d2p5pb_.
(The format of our PDB-style files is described here.)

Timeline for d2p5pb_: