Lineage for d2p4ja_ (2p4j A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800856Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2800857Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2801362Domain d2p4ja_: 2p4j A: [149210]
    automated match to d1fkna_
    complexed with 23i

Details for d2p4ja_

PDB Entry: 2p4j (more details), 2.5 Å

PDB Description: crystal structure of beta-secretase bond to an inhibitor with isophthalamide derivatives at p2-p3
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2p4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ja_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d2p4ja_:

Click to download the PDB-style file with coordinates for d2p4ja_.
(The format of our PDB-style files is described here.)

Timeline for d2p4ja_: