Lineage for d2p40a1 (2p40 A:8-264)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000000Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 1000001Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (3 species)
    structurally and functionally similar to VP39
  7. 1000002Species Dengue virus 2 [TaxId:11060] [159679] (5 PDB entries)
  8. 1000006Domain d2p40a1: 2p40 A:8-264 [149192]
    automatically matched to d1l9ka_
    complexed with gtg, so4

Details for d2p40a1

PDB Entry: 2p40 (more details), 2.7 Å

PDB Description: Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG
PDB Compounds: (A:) type II methyltransferase

SCOPe Domain Sequences for d2p40a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p40a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}
tlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfve
rnlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrlq
sgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpym
ssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmrh
kkatyepdvdlgsgtrn

SCOPe Domain Coordinates for d2p40a1:

Click to download the PDB-style file with coordinates for d2p40a1.
(The format of our PDB-style files is described here.)

Timeline for d2p40a1: