Lineage for d2oyna1 (2oyn A:2-136)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793812Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2793843Family b.43.5.2: CTP-dependent riboflavin kinase-like [159154] (1 protein)
    Pfam PF01982; newly characterized archaeal family (formerly DUF120)
  6. 2793844Protein CTP-dependent riboflavin kinase, Rfk [159155] (2 species)
  7. 2793845Species Methanococcus jannaschii [TaxId:2190] [159157] (6 PDB entries)
    Uniprot Q60365 1-136
  8. 2793847Domain d2oyna1: 2oyn A:2-136 [149067]
    Other proteins in same PDB: d2oyna2
    complexed with cdp, na

Details for d2oyna1

PDB Entry: 2oyn (more details), 1.85 Å

PDB Description: crystal structure of cdp-bound protein mj0056 from methanococcus jannaschii, pfam duf120
PDB Compounds: (A:) Hypothetical protein MJ0056

SCOPe Domain Sequences for d2oyna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyna1 b.43.5.2 (A:2-136) CTP-dependent riboflavin kinase, Rfk {Methanococcus jannaschii [TaxId: 2190]}
vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie
tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk
dgdvikilikgdkde

SCOPe Domain Coordinates for d2oyna1:

Click to download the PDB-style file with coordinates for d2oyna1.
(The format of our PDB-style files is described here.)

Timeline for d2oyna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oyna2