![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) ![]() |
![]() | Family b.43.5.2: CTP-dependent riboflavin kinase-like [159154] (1 protein) Pfam PF01982; newly characterized archaeal family (formerly DUF120) |
![]() | Protein CTP-dependent riboflavin kinase, Rfk [159155] (2 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [159157] (6 PDB entries) Uniprot Q60365 1-136 |
![]() | Domain d2oyna1: 2oyn A:2-136 [149067] Other proteins in same PDB: d2oyna2 complexed with cdp, na |
PDB Entry: 2oyn (more details), 1.85 Å
SCOPe Domain Sequences for d2oyna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyna1 b.43.5.2 (A:2-136) CTP-dependent riboflavin kinase, Rfk {Methanococcus jannaschii [TaxId: 2190]} vklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyie tedfefngkrffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlk dgdvikilikgdkde
Timeline for d2oyna1: