SCOPe 2.01: Domain d2oq4b2: 2oq4 B:1-124

Lineage for d2oq4b2 (2oq4 B:1-124)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)

6. Protein Endonuclease VIII [82233] (1 species)

7. Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
   Uniprot P50465

8. Domain d2oq4b2: 2oq4 B:1-124 [148982]
   Other proteins in same PDB: d2oq4a1, d2oq4a3, d2oq4b1, d2oq4b3
   automatically matched to d1k3wa2
   protein/DNA complex; complexed with na, so4, zn

Details for d2oq4b2

PDB Entry: 2oq4, 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate

PDB Compounds: (B:) Endonuclease VIII

SCOPe Domain Sequences for d2oq4b2:

Sequence; same for both SEQRES and ATOM records:

>d2oq4b2 b.113.1.1 (B:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pqgpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

Timeline for d2oq4b2:

• d2oq4b2 first appeared in SCOP 1.75
  
• d2oq4b2 appears in SCOPe 2.02
  
• d2oq4b2 appears in the current release, SCOPe 2.08