SCOPe 2.01: Domain d2oq4b1: 2oq4 B:125-212

Lineage for d2oq4b1 (2oq4 B:125-212)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein Endonuclease VIII [81703] (1 species)

7. Species Escherichia coli [TaxId:562] [81704] (8 PDB entries)
   Uniprot P50465

8. Domain d2oq4b1: 2oq4 B:125-212 [148981]
   Other proteins in same PDB: d2oq4a2, d2oq4a3, d2oq4b2, d2oq4b3
   automatically matched to d1k3wa1
   protein/DNA complex; complexed with na, so4, zn

Details for d2oq4b1

PDB Entry: 2oq4, 2.6 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate

PDB Compounds: (B:) Endonuclease VIII

SCOPe Domain Sequences for d2oq4b1:

Sequence; same for both SEQRES and ATOM records:

>d2oq4b1 a.156.1.2 (B:125-212) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatr

Timeline for d2oq4b1:

• d2oq4b1 first appeared in SCOP 1.75
  
• d2oq4b1 appears in SCOPe 2.02
  
• d2oq4b1 appears in the current release, SCOPe 2.08