Lineage for d2npoa1 (2npo A:3-195)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814163Family b.81.1.8: PglD-like [159280] (2 proteins)
    contains extra N-terminal alpha/beta subdomain
    this is a repeat family; one repeat unit is 2npo A:101-119 found in domain
  6. 2814164Protein Acetyltransferase PglD [159281] (1 species)
  7. 2814165Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
    Uniprot Q0P9D1 3-197
  8. 2814173Domain d2npoa1: 2npo A:3-195 [148338]
    Other proteins in same PDB: d2npoa2

Details for d2npoa1

PDB Entry: 2npo (more details), 2.2 Å

PDB Description: crystal structure of putative transferase from campylobacter jejuni subsp. jejuni nctc 11168
PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d2npoa1:

Sequence, based on SEQRES records: (download)

>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk
kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv
iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd
ekgvfvgvpakrm

Sequence, based on observed residues (ATOM records): (download)

>d2npoa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
rtekiyiygghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirkki
yqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvie
hecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdek
gvfvgvpakrm

SCOPe Domain Coordinates for d2npoa1:

Click to download the PDB-style file with coordinates for d2npoa1.
(The format of our PDB-style files is described here.)

Timeline for d2npoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2npoa2