Lineage for d2jsfa1 (2jsf A:10-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937854Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 937855Protein Envelope glycoprotein [49213] (5 species)
  7. 937856Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 937864Domain d2jsfa1: 2jsf A:10-107 [148191]
    automatically matched to d1tgea1

Details for d2jsfa1

PDB Entry: 2jsf (more details)

PDB Description: Solution structures of the envelope protein domain III from the dengue-2 virus
PDB Compounds: (A:) domain III of ENVELOPE PROTEIN E

SCOPe Domain Sequences for d2jsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jsfa1 b.1.18.4 (A:10-107) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg

SCOPe Domain Coordinates for d2jsfa1:

Click to download the PDB-style file with coordinates for d2jsfa1.
(The format of our PDB-style files is described here.)

Timeline for d2jsfa1: