Lineage for d2jsfa1 (2jsf A:10-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789318Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 789319Protein Envelope glycoprotein [49213] (5 species)
  7. 789320Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 789328Domain d2jsfa1: 2jsf A:10-107 [148191]
    automatically matched to d1tgea1

Details for d2jsfa1

PDB Entry: 2jsf (more details)

PDB Description: Solution structures of the envelope protein domain III from the dengue-2 virus
PDB Compounds: (A:) domain III of ENVELOPE PROTEIN E

SCOP Domain Sequences for d2jsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jsfa1 b.1.18.4 (A:10-107) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg

SCOP Domain Coordinates for d2jsfa1:

Click to download the PDB-style file with coordinates for d2jsfa1.
(The format of our PDB-style files is described here.)

Timeline for d2jsfa1: