SCOPe 2.01: Domain d2idgb_: 2idg B:

Lineage for d2idgb_ (2idg B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein Hypothetical protein AF0160 [158817] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [158818] (1 PDB entry)
   Uniprot O30077 1-160

8. Domain d2idgb_: 2idg B: [147628]
   automated match to d2idga1

Details for d2idgb_

PDB Entry: 2idg, 2.69 Å

PDB Description: crystal structure of hypothetical protein af0160 from archaeoglobus fulgidus

PDB Compounds: (B:) Hypothetical protein AF0160

SCOPe Domain Sequences for d2idgb_:

Sequence; same for both SEQRES and ATOM records:

>d2idgb_ a.184.1.1 (B:) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
smtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikd
mpqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyk
iraaqhrfikahlqplvknlpsapllnfvrdfvredakylyss

Timeline for d2idgb_:

• d2idgb_ first appeared in SCOP 1.75, called d2idgb1
  
• d2idgb_ appears in SCOPe 2.02
  
• d2idgb_ appears in the current release, SCOPe 2.08, called d2idgb2