SCOPe 2.01: Domain d2idga1: 2idg A:1-160

Lineage for d2idga1 (2idg A:1-160)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein Hypothetical protein AF0160 [158817] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [158818] (1 PDB entry)
   Uniprot O30077 1-160

8. Domain d2idga1: 2idg A:1-160 [147627]

Details for d2idga1

PDB Entry: 2idg, 2.69 Å

PDB Description: crystal structure of hypothetical protein af0160 from archaeoglobus fulgidus

PDB Compounds: (A:) Hypothetical protein AF0160

SCOPe Domain Sequences for d2idga1:

Sequence; same for both SEQRES and ATOM records:

>d2idga1 a.184.1.1 (A:1-160) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakyly

Timeline for d2idga1:

• d2idga1 first appeared in SCOP 1.75
  
• d2idga1 appears in SCOPe 2.02
  
• d2idga1 appears in the current release, SCOPe 2.08