Lineage for d2i6eg_ (2i6e G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185848Protein Hypothetical protein DR0370 [159814] (1 species)
  7. 1185849Species Deinococcus radiodurans [TaxId:1299] [159815] (1 PDB entry)
    Uniprot Q9RXE3 14-285
  8. 1185856Domain d2i6eg_: 2i6e G: [147526]
    automated match to d2i6ea1
    complexed with so4

Details for d2i6eg_

PDB Entry: 2i6e (more details), 2.5 Å

PDB Description: crystal structure of protein dr0370 from deinococcus radiodurans, pfam duf178
PDB Compounds: (G:) hypothetical protein

SCOPe Domain Sequences for d2i6eg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6eg_ c.94.1.1 (G:) Hypothetical protein DR0370 {Deinococcus radiodurans [TaxId: 1299]}
pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt
laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler
aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf
dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy
lwnfryhleapdrlglrefadlavpghaeltf

SCOPe Domain Coordinates for d2i6eg_:

Click to download the PDB-style file with coordinates for d2i6eg_.
(The format of our PDB-style files is described here.)

Timeline for d2i6eg_: