Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Hypothetical protein DR0370 [159814] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [159815] (1 PDB entry) Uniprot Q9RXE3 14-285 |
Domain d2i6ed_: 2i6e D: [147523] automated match to d2i6ea1 complexed with so4 |
PDB Entry: 2i6e (more details), 2.5 Å
SCOPe Domain Sequences for d2i6ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6ed_ c.94.1.1 (D:) Hypothetical protein DR0370 {Deinococcus radiodurans [TaxId: 1299]} pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy lwnfryhleapdrlglrefadlavpghaeltf
Timeline for d2i6ed_: