![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator SCO4940 [158250] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [158251] (1 PDB entry) Uniprot Q8CJS4 8-82 |
![]() | Domain d2hyja1: 2hyj A:8-82 [147456] Other proteins in same PDB: d2hyja2 complexed with ca, so4 |
PDB Entry: 2hyj (more details), 2.19 Å
SCOPe Domain Sequences for d2hyja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]} aeaqatrgrilgraaeiaseegldgitigrlaeelemsksgvhkhfgtketlqistldka fvdfwhrvvepalae
Timeline for d2hyja1: