Lineage for d2hyja1 (2hyj A:8-82)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477968Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1478141Protein Putative transcriptional regulator SCO4940 [158250] (1 species)
  7. 1478142Species Streptomyces coelicolor [TaxId:1902] [158251] (1 PDB entry)
    Uniprot Q8CJS4 8-82
  8. 1478143Domain d2hyja1: 2hyj A:8-82 [147456]
    Other proteins in same PDB: d2hyja2
    complexed with ca, so4

Details for d2hyja1

PDB Entry: 2hyj (more details), 2.19 Å

PDB Description: The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
PDB Compounds: (A:) Putative tetR-family transcriptional regulator

SCOPe Domain Sequences for d2hyja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}
aeaqatrgrilgraaeiaseegldgitigrlaeelemsksgvhkhfgtketlqistldka
fvdfwhrvvepalae

SCOPe Domain Coordinates for d2hyja1:

Click to download the PDB-style file with coordinates for d2hyja1.
(The format of our PDB-style files is described here.)

Timeline for d2hyja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hyja2