Lineage for d2g0ea2 (2g0e A:73-187)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1746767Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1746768Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1746769Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1746818Protein Multidrug binding protein QacR [69107] (1 species)
  7. 1746819Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 1746862Domain d2g0ea2: 2g0e A:73-187 [147059]
    Other proteins in same PDB: d2g0ea1, d2g0eb1, d2g0ed1, d2g0ee1
    automated match to d1jt6b2
    complexed with cgq, so4

Details for d2g0ea2

PDB Entry: 2g0e (more details), 2.88 Å

PDB Description: Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2g0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0ea2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d2g0ea2:

Click to download the PDB-style file with coordinates for d2g0ea2.
(The format of our PDB-style files is described here.)

Timeline for d2g0ea2: