Class a: All alpha proteins [46456] (286 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Multidrug binding protein QacR [69107] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries) Uniprot P23217 |
Domain d2g0ea2: 2g0e A:73-187 [147059] Other proteins in same PDB: d2g0ea1, d2g0eb1, d2g0ed1, d2g0ee1 automated match to d1jt6b2 complexed with cgq, so4 |
PDB Entry: 2g0e (more details), 2.88 Å
SCOPe Domain Sequences for d2g0ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g0ea2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d2g0ea2: