SCOPe 2.05: Domain d2g0ea1: 2g0e A:2-72

Lineage for d2g0ea1 (2g0e A:2-72)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d2g0ea1: 2g0e A:2-72 [147058]
   Other proteins in same PDB: d2g0ea2, d2g0eb2, d2g0ed2, d2g0ee2
   automated match to d1jt6b1
   complexed with cgq, so4

Details for d2g0ea1

PDB Entry: 2g0e, 2.88 Å

PDB Description: Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2g0ea1:

Sequence; same for both SEQRES and ATOM records:

>d2g0ea1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d2g0ea1:

• d2g0ea1 first appeared in SCOP 1.75
  
• d2g0ea1 appears in SCOPe 2.04
  
• d2g0ea1 appears in SCOPe 2.06
  
• d2g0ea1 appears in the current release, SCOPe 2.08