Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Pullulanase PulA [159262] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries) Uniprot P07206 973-1090 |
Domain d2fhca4: 2fhc A:966-1083 [147033] Other proteins in same PDB: d2fhca1, d2fhca2, d2fhca3, d2fhca5 automated match to d2fhfa4 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2fhc (more details), 1.85 Å
SCOPe Domain Sequences for d2fhca4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhca4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk
Timeline for d2fhca4:
View in 3D Domains from same chain: (mouse over for more information) d2fhca1, d2fhca2, d2fhca3, d2fhca5 |