Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.17: TTHA0227-like [160555] (2 proteins) PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures |
Protein Uncharacterized protein TTHA0227 [160556] (1 species) |
Species Thermus thermophilus [TaxId:274] [160557] (1 PDB entry) Uniprot Q5SLR6 2-108 |
Domain d2ejqb_: 2ejq B: [146876] automated match to d2ejqa1 complexed with mg |
PDB Entry: 2ejq (more details), 2.08 Å
SCOPe Domain Sequences for d2ejqb_:
Sequence, based on SEQRES records: (download)
>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]} tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpgppsafggf edlgrhialyygsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldaf rrggps
>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]} tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpggrhialyy gsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldafrrggps
Timeline for d2ejqb_: