SCOPe 2.03: Domain d2ejqb_: 2ejq B:

Lineage for d2ejqb_ (2ejq B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
   PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures

6. Protein Uncharacterized protein TTHA0227 [160556] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160557] (1 PDB entry)
   Uniprot Q5SLR6 2-108

8. Domain d2ejqb_: 2ejq B: [146876]
   automated match to d2ejqa1
   complexed with mg

Details for d2ejqb_

PDB Entry: 2ejq, 2.08 Å

PDB Description: conserved hypothetical protein (ttha0227) from thermo thermophilus hb8

PDB Compounds: (B:) Hypothetical protein TTHA0227

SCOPe Domain Sequences for d2ejqb_:

Sequence, based on SEQRES records:

>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]}
tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpgppsafggf
edlgrhialyygsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldaf
rrggps

Sequence, based on observed residues (ATOM records):

>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]}
tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpggrhialyy
gsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldafrrggps

Timeline for d2ejqb_:

• d2ejqb_ first appeared in SCOP 1.75, called d2ejqb1
  
• d2ejqb_ was called d2ejqb1 in SCOPe 2.02
  
• d2ejqb_ appears in SCOPe 2.04
  
• d2ejqb_ appears in the current release, SCOPe 2.08