Lineage for d2ejqb_ (2ejq B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964864Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
    Pfam PFPF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
    Pfam PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
  6. 2964869Protein Uncharacterized protein TTHA0227 [160556] (1 species)
  7. 2964870Species Thermus thermophilus [TaxId:274] [160557] (1 PDB entry)
    Uniprot Q5SLR6 2-108
  8. 2964872Domain d2ejqb_: 2ejq B: [146876]
    automated match to d2ejqa1
    complexed with mg

Details for d2ejqb_

PDB Entry: 2ejq (more details), 2.08 Å

PDB Description: conserved hypothetical protein (ttha0227) from thermo thermophilus hb8
PDB Compounds: (B:) Hypothetical protein TTHA0227

SCOPe Domain Sequences for d2ejqb_:

Sequence, based on SEQRES records: (download)

>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]}
tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpgppsafggf
edlgrhialyygsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldaf
rrggps

Sequence, based on observed residues (ATOM records): (download)

>d2ejqb_ d.92.1.17 (B:) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]}
tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpggrhialyy
gsflevagegfdweaevwetmlhelrhhleslagrddlvqedlrrldafrrggps

SCOPe Domain Coordinates for d2ejqb_:

Click to download the PDB-style file with coordinates for d2ejqb_.
(The format of our PDB-style files is described here.)

Timeline for d2ejqb_: