Lineage for d2ejqa1 (2ejq A:2-108)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
Protein Uncharacterized protein TTHA0227 [160556] (1 species) Species Thermus thermophilus [TaxId:274] [160557] (1 PDB entry)
Uniprot Q5SLR6 2-108
Domain d2ejqa1: 2ejq A:2-108 [146875]
complexed with mg
Details for d2ejqa1
PDB Entry: 2ejq (more details), 2.08 Å
PDB Description: conserved hypothetical protein (ttha0227) from thermo thermophilus hb8
PDB Compounds: (A:) Hypothetical protein TTHA0227SCOPe Domain Sequences for d2ejqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejqa1 d.92.1.17 (A:2-108) Uncharacterized protein TTHA0227 {Thermus thermophilus [TaxId: 274]}
tyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpgppsafggf
edlgrhialyygsflevagegfdweaevwetmlhelrhhleslagrd
SCOPe Domain Coordinates for d2ejqa1:
Click to download the PDB-style file with coordinates for d2ejqa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ejqa1:
- d2ejqa1 first appeared in SCOP 1.75
- d2ejqa1 appears in SCOPe 2.02
- d2ejqa1 appears in SCOPe 2.04
- d2ejqa1 appears in the current release, SCOPe 2.08
View in 3D
