SCOPe 2.06: Domain d2ec9l2: 2ec9 L:87-142

Lineage for d2ec9l2 (2ec9 L:87-142)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries)

8. Domain d2ec9l2: 2ec9 L:87-142 [146787]
   Other proteins in same PDB: d2ec9h_, d2ec9l1, d2ec9l3, d2ec9u_
   automated match to d2a2ql2
   complexed with 24x, aso, ca, fuc

Details for d2ec9l2

PDB Entry: 2ec9, 2 Å

PDB Description: crystal structure analysis of human factor viia , souluble tissue factor complexed with bcx-3607

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2ec9l2:

Sequence; same for both SEQRES and ATOM records:

>d2ec9l2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d2ec9l2:

• d2ec9l2 first appeared in SCOP 1.75
  
• d2ec9l2 appears in SCOPe 2.05
  
• d2ec9l2 appears in SCOPe 2.07
  
• d2ec9l2 appears in the current release, SCOPe 2.08