Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries) |
Domain d2ec9l2: 2ec9 L:87-142 [146787] Other proteins in same PDB: d2ec9h_, d2ec9l1, d2ec9l3, d2ec9u_ automated match to d2a2ql2 complexed with 24x, aso, ca, fuc |
PDB Entry: 2ec9 (more details), 2 Å
SCOPe Domain Sequences for d2ec9l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ec9l2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2ec9l2: