Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein automated matches [190888] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries) |
Domain d2ec9u_: 2ec9 U: [161411] Other proteins in same PDB: d2ec9h_, d2ec9l1, d2ec9l2, d2ec9l3 automated match to d2c4fu1 complexed with 24x, aso, ca, fuc |
PDB Entry: 2ec9 (more details), 2 Å
SCOPe Domain Sequences for d2ec9u_:
Sequence, based on SEQRES records: (download)
>d2ec9u_ b.1.2.1 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eplyenspeftpyletnlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkd liytlyywkssssgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
>d2ec9u_ b.1.2.1 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eplyenspeftpyletnlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkd liytlyywsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Timeline for d2ec9u_:
View in 3D Domains from other chains: (mouse over for more information) d2ec9h_, d2ec9l1, d2ec9l2, d2ec9l3 |