Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.25: Rv3472-like [160024] (3 proteins) similar trimer to Scytalone dehydratase |
Protein automated matches [190557] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187544] (1 PDB entry) |
Domain d2chcb_: 2chc B: [146395] Other proteins in same PDB: d2chca1 automated match to d2chca1 |
PDB Entry: 2chc (more details), 1.69 Å
SCOPe Domain Sequences for d2chcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chcb_ d.17.4.25 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} eqwieilriqalcarycltintqdgegwagcftedgafefdgwvirgrpalreyadahar vvrgrhlttdllyevdgdvatgrsasvvtlataagykilgsgeyqdrlikqdgqwriayr rlrndrlvsdpsvavnvadadvaavvghllaaarrlgtqms
Timeline for d2chcb_: