SCOPe 2.01: Domain d2chcb_: 2chc B:

Lineage for d2chcb_ (2chc B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.25: Rv3472-like [160024] (3 proteins)
   similar trimer to Scytalone dehydratase

6. Protein automated matches [190557] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187544] (1 PDB entry)

8. Domain d2chcb_: 2chc B: [146395]
   Other proteins in same PDB: d2chca1
   automated match to d2chca1

Details for d2chcb_

PDB Entry: 2chc, 1.69 Å

PDB Description: structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis

PDB Compounds: (B:) protein rv3472

SCOPe Domain Sequences for d2chcb_:

Sequence; same for both SEQRES and ATOM records:

>d2chcb_ d.17.4.25 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eqwieilriqalcarycltintqdgegwagcftedgafefdgwvirgrpalreyadahar
vvrgrhlttdllyevdgdvatgrsasvvtlataagykilgsgeyqdrlikqdgqwriayr
rlrndrlvsdpsvavnvadadvaavvghllaaarrlgtqms

Timeline for d2chcb_:

• d2chcb_ first appeared in SCOP 1.75, called d2chcb1
  
• d2chcb_ appears in SCOPe 2.02
  
• d2chcb_ appears in the current release, SCOPe 2.08