Lineage for d2chcb1 (2chc B:6-166)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 856097Family d.17.4.25: Rv3472-like [160024] (2 proteins)
    similar trimer to Scytalone dehydratase
  6. 856103Protein Uncharacterized protein Rv3472 [160027] (1 species)
  7. 856104Species Mycobacterium tuberculosis [TaxId:1773] [160028] (1 PDB entry)
    Uniprot O06337 1-167
  8. 856106Domain d2chcb1: 2chc B:6-166 [146395]
    automatically matched to 2CHC A:1-167
    mutant

Details for d2chcb1

PDB Entry: 2chc (more details), 1.69 Å

PDB Description: structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis
PDB Compounds: (B:) protein rv3472

SCOP Domain Sequences for d2chcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chcb1 d.17.4.25 (B:6-166) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]}
eqwieilriqalcarycltintqdgegwagcftedgafefdgwvirgrpalreyadahar
vvrgrhlttdllyevdgdvatgrsasvvtlataagykilgsgeyqdrlikqdgqwriayr
rlrndrlvsdpsvavnvadadvaavvghllaaarrlgtqms

SCOP Domain Coordinates for d2chcb1:

Click to download the PDB-style file with coordinates for d2chcb1.
(The format of our PDB-style files is described here.)

Timeline for d2chcb1: