| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) |
| Domain d2j6eh2: 2j6e H:114-214 [145666] Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6ei1, d2j6el1, d2j6el2, d2j6em1, d2j6em2 complexed with act, cac, cd, mpd, zn |
PDB Entry: 2j6e (more details), 3 Å
SCOPe Domain Sequences for d2j6eh2:
Sequence, based on SEQRES records: (download)
>d2j6eh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpskdvmqgtdehvvckvqhpngnkeknvp
>d2j6eh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllpskdvmqgtdehvvckvqhpngnkeknvp
Timeline for d2j6eh2: