Lineage for d2j6eh2 (2j6e H:114-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516238Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 1516239Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 1516251Domain d2j6eh2: 2j6e H:114-214 [145666]
    Other proteins in same PDB: d2j6ea1, d2j6ea2, d2j6eb1, d2j6eb2, d2j6eh1, d2j6ei1, d2j6el1, d2j6el2, d2j6em1, d2j6em2
    complexed with act, cac, cd, mpd, zn

Details for d2j6eh2

PDB Entry: 2j6e (more details), 3 Å

PDB Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
PDB Compounds: (H:) igm

SCOPe Domain Sequences for d2j6eh2:

Sequence, based on SEQRES records: (download)

>d2j6eh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpskdvmqgtdehvvckvqhpngnkeknvp

Sequence, based on observed residues (ATOM records): (download)

>d2j6eh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllpskdvmqgtdehvvckvqhpngnkeknvp

SCOPe Domain Coordinates for d2j6eh2:

Click to download the PDB-style file with coordinates for d2j6eh2.
(The format of our PDB-style files is described here.)

Timeline for d2j6eh2: