Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 2, USP2 [159841] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159842] (2 PDB entries) Uniprot O75604 263-600! Uniprot O75604 264-599 |
Domain d2ibia1: 2ibi A:263-600 [145520] Other proteins in same PDB: d2ibib_ complexed with neh, zn |
PDB Entry: 2ibi (more details), 2.2 Å
SCOPe Domain Sequences for d2ibia1:
Sequence, based on SEQRES records: (download)
>d2ibia1 d.3.1.9 (A:263-600) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls lpiakrgypevtlmdcmrlftkedvldgdaaptccrcrgrkrcikkfsiqrfpkilvlhl krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc rspgtgewhtfndssvtpmsssqvrtsdayllfyelas
>d2ibia1 d.3.1.9 (A:263-600) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpkn penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl piakrgpevtlmdcmrlftkedvldgdaaptccrcrgrkrcikkfsiqrfpkilvlhlkr fsesrirtsklttfvnfplrdldlrefasenthavynlyavsnhsgttmgghytaycrsp gtgewhtfndssvtpmsssqvrtsdayllfyelas
Timeline for d2ibia1: