SCOPe 2.08: Domain d2hyec1: 2hye C:676-759

Lineage for d2hyec1 (2hye C:676-759)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins)

6. Protein Cullin-4A [158288] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158289] (1 PDB entry)
   Uniprot Q13619 676-759

8. Domain d2hyec1: 2hye C:676-759 [145414]
   Other proteins in same PDB: d2hyeb_, d2hyec2, d2hyec3, d2hyed_
   complexed with zn

Details for d2hyec1

PDB Entry: 2hye, 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex

PDB Compounds: (C:) Cullin-4A

SCOPe Domain Sequences for d2hyec1:

Sequence; same for both SEQRES and ATOM records:

>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]}
etveeqvsttervfqdrqyqidaaivrimkmrktlghnllvselynqlkfpvkpgdlkkr
ieslidrdymerdkdnpnqyhyva

Timeline for d2hyec1:

• d2hyec1 first appeared in SCOP 1.75
  
• d2hyec1 appears in SCOPe 2.07