Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.34: SCF ubiquitin ligase complex WHB domain [74679] (3 proteins) |
Protein Cullin-4A [158288] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158289] (1 PDB entry) Uniprot Q13619 676-759 |
Domain d2hyec1: 2hye C:676-759 [145414] Other proteins in same PDB: d2hyec2, d2hyec3, d2hyed1 complexed with zn |
PDB Entry: 2hye (more details), 3.1 Å
SCOP Domain Sequences for d2hyec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} etveeqvsttervfqdrqyqidaaivrimkmrktlghnllvselynqlkfpvkpgdlkkr ieslidrdymerdkdnpnqyhyva
Timeline for d2hyec1: