Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
Protein Ribosomal protein L32p [144201] (3 species) |
Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries) Uniprot P80339 1-59 |
Domain d2hgj41: 2hgj 4:4-60 [145300] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to 2J01 5:2-60 |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgj41:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgj41 g.41.8.5 (4:4-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} hpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
Timeline for d2hgj41:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |