Lineage for d2hgjv1 (2hgj V:2-110)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203503Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1203504Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1203505Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1203506Protein Ribosomal protein L22 [54845] (5 species)
  7. 1203607Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 1203611Domain d2hgjv1: 2hgj V:2-110 [145324]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjw1, d2hgjx1, d2hgjy1
    automatically matched to d1bxea_

Details for d2hgjv1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (V:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2hgjv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjv1 d.55.1.1 (V:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2hgjv1:

Click to download the PDB-style file with coordinates for d2hgjv1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjv1: