| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries) |
| Domain d2e75b1: 2e75 B:1-160 [145114] Other proteins in same PDB: d2e75a1, d2e75d1, d2e75d2, d2e75e1, d2e75f1, d2e75g1, d2e75h1 automatically matched to 2E74 B:1-160 complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e75b1 f.32.1.1 (B:1-160) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
Timeline for d2e75b1: