| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103499] (4 PDB entries) |
| Domain d2e75a1: 2e75 A:13-214 [132053] Other proteins in same PDB: d2e75b1, d2e75d1, d2e75d2, d2e75e1, d2e75f1, d2e75g1, d2e75h1 automatically matched to d1vf5a_ complexed with bcr, cd, cla, fes, hem, opc, qno, sqd, umq |
PDB Entry: 2e75 (more details), 3.55 Å
SCOPe Domain Sequences for d2e75a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e75a1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp
Timeline for d2e75a1: