Lineage for d2b9p51 (2b9p 5:2-59)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245496Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1245497Protein Ribosomal protein L32p [144201] (3 species)
  7. 1245533Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 1245543Domain d2b9p51: 2b9p 5:2-59 [144978]
    Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
    automatically matched to 2ZJR Z:2-59
    protein/RNA complex

Details for d2b9p51

PDB Entry: 2b9p (more details), 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2b9p51:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9p51 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d2b9p51:

Click to download the PDB-style file with coordinates for d2b9p51.
(The format of our PDB-style files is described here.)

Timeline for d2b9p51: