Class j: Peptides [58231] (120 folds) |
Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) |
Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
Protein Ribosomal protein L34p [144323] (3 species) |
Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries) Uniprot P80340 1-49 |
Domain d2b9p71: 2b9p 7:1-46 [144979] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1 automatically matched to 2ZJR 2:1-46 protein/RNA complex |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9p71:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9p71 j.118.1.1 (7:1-46) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
Timeline for d2b9p71: