Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161036] (4 PDB entries) Uniprot Q8DHA7 1-36 |
Domain d2axtm1: 2axt M:1-36 [144937] Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axth1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1 complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk |
PDB Entry: 2axt (more details), 3 Å
SCOPe Domain Sequences for d2axtm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axtm1 f.23.35.1 (M:1-36) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]} mevnqlgliatalfvlvpsvfliilyvqtesqqkss
Timeline for d2axtm1: