Lineage for d2axth1 (2axt H:2-65)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958475Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 1958476Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 1958477Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 1958478Species Thermosynechococcus elongatus [TaxId:146786] [161028] (2 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 1958480Domain d2axth1: 2axt H:2-65 [144932]
    Other proteins in same PDB: d2axta1, d2axtb1, d2axtc1, d2axtd1, d2axte1, d2axtf1, d2axti1, d2axtj1, d2axtk1, d2axtl1, d2axtm1, d2axto1, d2axtt1, d2axtu1, d2axtv_, d2axtz1
    complexed with bcr, bct, ca, cla, dgd, fe2, hem, lhg, lmt, mge, oec, pho, pq9, sqd, unk

Details for d2axth1

PDB Entry: 2axt (more details), 3 Å

PDB Description: crystal structure of photosystem ii from thermosynechococcus elongatus
PDB Compounds: (H:) Photosystem II reaction center H protein

SCOPe Domain Sequences for d2axth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axth1 f.23.33.1 (H:2-65) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

SCOPe Domain Coordinates for d2axth1:

Click to download the PDB-style file with coordinates for d2axth1.
(The format of our PDB-style files is described here.)

Timeline for d2axth1: