Lineage for d1zmya1 (1zmy A:1-133)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021390Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 2021391Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
    SQ NA # camelid antibody
  8. 2021419Domain d1zmya1: 1zmy A:1-133 [144746]
    Other proteins in same PDB: d1zmyl_, d1zmym_

Details for d1zmya1

PDB Entry: 1zmy (more details), 3 Å

PDB Description: cAbBCII-10 VHH framework with CDR loops of cAbLys3 grafted on it and in complex with hen egg white lysozyme
PDB Compounds: (A:) Antibody cabbcII-10:lys3

SCOPe Domain Sequences for d1zmya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmya1 b.1.1.1 (A:1-133) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgytigpycmgwfrqapggereavaainmgggityy
adsvkgrftisrdnakntvtlqmnslkpedtamyycaadstiyasyyecghglstggygy
dswgqgtqvtvss

SCOPe Domain Coordinates for d1zmya1:

Click to download the PDB-style file with coordinates for d1zmya1.
(The format of our PDB-style files is described here.)

Timeline for d1zmya1: