Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries) SQ NA # camelid antibody |
Domain d1zmya1: 1zmy A:1-133 [144746] Other proteins in same PDB: d1zmyl_, d1zmym_ |
PDB Entry: 1zmy (more details), 3 Å
SCOPe Domain Sequences for d1zmya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zmya1 b.1.1.1 (A:1-133) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvesgggsvqaggslrlsctasgytigpycmgwfrqapggereavaainmgggityy adsvkgrftisrdnakntvtlqmnslkpedtamyycaadstiyasyyecghglstggygy dswgqgtqvtvss
Timeline for d1zmya1: