Lineage for d1wlpb2 (1wlp B:151-214)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053998Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species)
  7. 2053999Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries)
  8. 2054009Domain d1wlpb2: 1wlp B:151-214 [144558]
    Other proteins in same PDB: d1wlpb3

Details for d1wlpb2

PDB Entry: 1wlp (more details)

PDB Description: solution structure of the p22phox-p47phox complex
PDB Compounds: (B:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1wlpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlpb2 b.34.2.1 (B:151-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]}
ditgpiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipasfl
epld

SCOPe Domain Coordinates for d1wlpb2:

Click to download the PDB-style file with coordinates for d1wlpb2.
(The format of our PDB-style files is described here.)

Timeline for d1wlpb2: