PDB entry 1wlp

View 1wlp on RCSB PDB site
Description: Solution Structure Of The P22Phox-P47Phox Complex
Class: OXIDOREDUCTASE/Signaling Protein
Keywords: SH3 domain, polyproline, OXIDOREDUCTASE/Signaling Protein COMPLEX
Deposited on 2004-06-29, released 2005-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome b-245 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13498 (5-24)
    • cloning artifact (0-4)
• Chain 'B':
  Compound: neutrophil cytosol factor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14598 (2-137)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1wlpb1, d1wlpb2, d1wlpb3

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wlpB (B:)
  gsditgpiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipas
  flepldspdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirk
  ddvtgyfpsmylqksgqd