Lineage for d1vgka1 (1vgk A:182-274)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514415Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1514700Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1514724Domain d1vgka1: 1vgk A:182-274 [144407]
    Other proteins in same PDB: d1vgka2, d1vgkb_
    automatically matched to 2FWO A:182-275

Details for d1vgka1

PDB Entry: 1vgk (more details), 2.06 Å

PDB Description: The crystal structure of class I Major histocompatibility complex, H-2Kd at 2.0 A resolution
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d1vgka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgka1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrw

SCOPe Domain Coordinates for d1vgka1:

Click to download the PDB-style file with coordinates for d1vgka1.
(The format of our PDB-style files is described here.)

Timeline for d1vgka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgka2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vgkb_