Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RPB3 [64462] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
Domain d2yu9c2: 2yu9 C:42-172 [140067] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1i3qc2 protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOPe Domain Sequences for d2yu9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d2yu9c2: