SCOPe 2.05: Domain d2yu9c2: 2yu9 C:42-172

Lineage for d2yu9c2 (2yu9 C:42-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2yu9c2: 2yu9 C:42-172 [140067]
   Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1
   automatically matched to d1i3qc2
   protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2yu9c2

PDB Entry: 2yu9, 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2yu9c2:

Sequence; same for both SEQRES and ATOM records:

>d2yu9c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d2yu9c2:

• d2yu9c2 first appeared in SCOP 1.73
  
• d2yu9c2 appears in SCOPe 2.04
  
• d2yu9c2 appears in SCOPe 2.06
  
• d2yu9c2 appears in the current release, SCOPe 2.08