Lineage for d2uuch1 (2uuc H:1-138)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873626Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 873627Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 873628Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 873629Protein Ribosomal protein S8 [56049] (4 species)
  7. 873647Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 873658Domain d2uuch1: 2uuc H:1-138 [139960]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1fjgh_
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uuch1

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOP Domain Sequences for d2uuch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuch1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d2uuch1:

Click to download the PDB-style file with coordinates for d2uuch1.
(The format of our PDB-style files is described here.)

Timeline for d2uuch1: