Lineage for d2uucc2 (2uuc C:107-207)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860387Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 860388Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 860389Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 860390Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 860416Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 860423Domain d2uucc2: 2uuc C:107-207 [139954]
    Other proteins in same PDB: d2uucb1, d2uucc1, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uucn1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1
    automatically matched to d1fjgc2
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uucc2

PDB Entry: 2uuc (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2uucc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uucc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d2uucc2:

Click to download the PDB-style file with coordinates for d2uucc2.
(The format of our PDB-style files is described here.)

Timeline for d2uucc2: