![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries) Uniprot P24320 |
![]() | Domain d2uucn1: 2uuc N:2-61 [139965] Other proteins in same PDB: d2uucb1, d2uucc1, d2uucc2, d2uucd1, d2uuce1, d2uuce2, d2uucf1, d2uucg1, d2uuch1, d2uucj1, d2uuck1, d2uucl1, d2uucm1, d2uuco1, d2uucp1, d2uucq1, d2uucr1, d2uucs1, d2uuct1, d2uucu1 automatically matched to d1fjgn_ complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uuc (more details), 3.1 Å
SCOP Domain Sequences for d2uucn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uucn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d2uucn1: